PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_009588904.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family NAC
Protein Properties Length: 520aa    MW: 59556.4 Da    PI: 5.4534
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_009588904.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM181.52.1e-5661341129
             NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 
                     lppGfrFhPtdeelv +yLk+k++g+k+el evi+evd+yk+ePwdLp k  + +++ ewyfFs+rd+ky++g+r+nratk+gyWkatgkd++v 
  XP_009588904.1   6 LPPGFRFHPTDEELVAYYLKRKINGRKIEL-EVIPEVDLYKCEPWDLPdKsVLPSKDLEWYFFSPRDRKYPNGTRTNRATKAGYWKATGKDRKVN 99 
                     79****************************.99**************96434555777************************************* PP

             NAM  94 skkgelvglkktLvfykgrapkgektdWvmheyrle 129
                     s + +++g+kktLv+y+grap+g++t Wvmheyrle
  XP_009588904.1 100 S-QMRAIGMKKTLVYYRGRAPHGSRTGWVMHEYRLE 134
                     *.9999****************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.22E-634156IPR003441NAC domain
PROSITE profilePS5100561.7816156IPR003441NAC domain
PfamPF023652.3E-307133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 520 aa     Download sequence    Send to blast
MAPVSLPPGF RFHPTDEELV AYYLKRKING RKIELEVIPE VDLYKCEPWD LPDKSVLPSK  60
DLEWYFFSPR DRKYPNGTRT NRATKAGYWK ATGKDRKVNS QMRAIGMKKT LVYYRGRAPH  120
GSRTGWVMHE YRLEERECEV ANGMQDAYAL CRVFKKSLNA PKSGDHYASD RSSSIDVYTE  180
ESRFDDIDHT SPNYGMPMNV AATTHDDKWM QYLSDEAFTS INPNSNGYHP SKVDVALECA  240
RLQHRFALPP LEVQDFPQVG YVDSRTISQS NDHLMYQTTN QTDIVQEILS VAQASHHLTN  300
QDSWGGNYSY APPCDDFSFL PHNNQLIHDL GDSFNFMEQL NEDHNARSIA VTDFDDKTFL  360
EDYKTVPIEN ISGPHKEEQD LQGEASGVHN SLNEIEANNF SLGFGNDSFL DDEETDGFEV  420
YEKIEVRQLG LFVATRQAAN TFYHQVVPSK TVTVHRDLEH DFPIRKIQEN ATLLDTFMAF  480
SRKTLSGVMR VTRPWKGKVS TLVDMIAPLY TFWSILGNAY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4dul_B6e-56116212171NAC domain-containing protein 19
4dul_A6e-56116212171NAC domain-containing protein 19
1ut7_B6e-56116212171NO APICAL MERISTEM PROTEIN
1ut7_A6e-56116212171NO APICAL MERISTEM PROTEIN
1ut4_B6e-56116212171NO APICAL MERISTEM PROTEIN
1ut4_A6e-56116212171NO APICAL MERISTEM PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG9754418e-48HG975441.1 Solanum pennellii chromosome ch02, complete genome.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009588904.10.0PREDICTED: protein BEARSKIN1-like
TrEMBLM1BXQ90.0M1BXQ9_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000553220.0(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA14952348
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G65910.11e-136NAC domain containing protein 28